| HMRbase accession number | 10518 |
| Swiss-prot Accession number | Q9VLK4 (Sequence in FASTA format) |
| Description | Diuretic hormone class-II precursor (Diuretic peptide) (DP) (DH(31)). |
| Source organism | Drosophila melanogaster (Fruit fly) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha;Ephydroidea; Drosophilidae; Drosophila. |
| Subcellular location | Secreted protein (By similarity) |
| Developmental Stage | N/A |
| Similarity | Belongs to the diuretic hormone class II family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Regulation of fluid secretion. Stimulates Malpighian tubules fluid secretion by activating the apical membrane V-ATPase via cyclic AMP of principal cells in the main secretory segment |
| Protein Length | 116 Amino acids |
| Molecular weight | 12622 |
| References | 1 PubMed abstract 10731132
2 PubMed abstract 12537572
3 Stapleton M., Carlson J.W., Chavez C., Frise E., George R.A.,Pacleb J.M., Park S., Wan K.H., Yu C., Rubin G.M., Celniker S.E.; Submitted (APR-2004) to the EMBL/GenBank/DDBJ databases.
4 PubMed abstract 11316500
|
| Domain Name | N/A |
| Hormone Name | Diuretic hormone class-II |
| Mature Hormone Sequence | TVDFGLARGYSGTQEAKHRMGLAAANFAGGP |
| Position of mature hormone in Pre-Hormone protein | 31 Residues from position (76-106) |
| Receptor | N/A |
| Gene ID | 34181 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
A database of hormones and their receptors